PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G01540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 650aa    MW: 72807.3 Da    PI: 6.474
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G01540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.69.4e-5761331128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtdeel+ +yLk+k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v
  OGLUM03G01540.1   6 LPPGFRFHPTDEELIIYYLKRKINGRQIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKV 98 
                      79****************************.99**************95334455777************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s ++++vg+kktLv+y+grap+g++tdWvmheyrl
  OGLUM03G01540.1  99 NS-QRRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                      **.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-644156IPR003441NAC domain
PROSITE profilePS5100561.5476156IPR003441NAC domain
PfamPF023651.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI IYYLKRKING RQIELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QRRAVGMKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDERECET DTGLQDAYAL CRVFKKTAPG PKIIEHYGVV HHHVEQPQWM  180
TSSIDRSPTL DVSCDGRGDD FESSSFSFPT ETPMDSMHGG FGMQMSAPHE DGKWMQFLSE  240
DAFNATNPFL TNPVSANFSC LPSKVDVALE CARLQHRLTL PPLEVEDFPQ DVSLDTKTGI  300
LRSNPNEVDI LQEFLSVATA SQELINGSTS SYPEMWLGAS TSSASYVNEL SSLVEMGGVG  360
TSNHHESARL QVEIADMEVF KDDKKRVENL RGVKLVNNDL GEIVVEGDES NPTEDIIAQY  420
PIKVTADNSG EAGHRMTDPT DVGGIDTAPI FSQSQPDDFA AGFDDVNPNA SFDLYEKVDV  480
NHRLFVSRVA AAKTFFHRIE PSKKVSFHSN PAATAVSKAT EKFHFPVTTK VSGRVSIFSK  540
FKALIRDKFL MMRPSHSYQR LGSKETTVNE LLQIVSLLLA PKQINGCPTE QELVKKKAKE  600
VMKPGWGREG SNKLWLPLSK GKGISSMFLS GKWTFLTSAL AISTPAECDH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-56116212171NO APICAL MERISTEM PROTEIN
1ut4_B8e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_A8e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_B8e-56116212171NO APICAL MERISTEM PROTEIN
3swm_A9e-56116215174NAC domain-containing protein 19
3swm_B9e-56116215174NAC domain-containing protein 19
3swm_C9e-56116215174NAC domain-containing protein 19
3swm_D9e-56116215174NAC domain-containing protein 19
3swp_A9e-56116215174NAC domain-containing protein 19
3swp_B9e-56116215174NAC domain-containing protein 19
3swp_C9e-56116215174NAC domain-containing protein 19
3swp_D9e-56116215174NAC domain-containing protein 19
4dul_A8e-56116212171NAC domain-containing protein 19
4dul_B8e-56116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2658210.0AB265821.1 Oryza sativa Japonica Group RIM1 mRNA for NAC protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628513.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628514.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628515.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628516.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628517.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628518.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628519.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628520.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628521.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
TrEMBLA0A0D9Z1A90.0A0A0D9Z1A9_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g02800.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP66243651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-127NAC domain containing protein 28